XRN1 anticorps (Middle Region)

N° du produit ABIN633318

Cet anticorps anti-XRN1 est un anticorps Lapin Polyclonal détectant XRN1 dans WB. Adapté pour Humain et Rat.

Aperçu rapide pour XRN1 anticorps (Middle Region) (ABIN633318)

Antigène: XRN1 (5'-3' Exoribonuclease 1 (XRN1))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp XRN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-XRN1 anticorps

Épitope: Middle Region

Specificité: XRN1 antibody was raised against the middle region of XRN1

Purification: Affinity purified

Immunogène: XRN1 antibody was raised using the middle region of XRN1 corresponding to a region with amino acids LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

XRN1 Blocking Peptide, (ABIN5617047), is also available for use as a blocking control in assays to test for specificity of this XRN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur XRN1

Antigène: XRN1 (5'-3' Exoribonuclease 1 (XRN1))

Autre désignation: XRN1

Sujet: SEP1 (XRN1) localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly.

Poids moléculaire: 194 kDa (MW of target protein)